AKAP6 monoclonal antibody (M01), clone 1E7 View larger

AKAP6 monoclonal antibody (M01), clone 1E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKAP6 monoclonal antibody (M01), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about AKAP6 monoclonal antibody (M01), clone 1E7

Brand: Abnova
Reference: H00009472-M01
Product name: AKAP6 monoclonal antibody (M01), clone 1E7
Product description: Mouse monoclonal antibody raised against a partial recombinant AKAP6.
Clone: 1E7
Isotype: IgG2a Kappa
Gene id: 9472
Gene name: AKAP6
Gene alias: ADAP100|ADAP6|AKAP100|KIAA0311|MGC165020|PRKA6|mAKAP
Gene description: A kinase (PRKA) anchor protein 6
Genbank accession: NM_004274
Immunogen: AKAP6 (NP_004265.3, 2221 a.a. ~ 2318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH
Protein accession: NP_004265.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009472-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged AKAP6 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy AKAP6 monoclonal antibody (M01), clone 1E7 now

Add to cart