| Brand: | Abnova |
| Reference: | H00009470-M01 |
| Product name: | EIF4E2 monoclonal antibody (M01), clone 4G10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EIF4E2. |
| Clone: | 4G10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9470 |
| Gene name: | EIF4E2 |
| Gene alias: | 4E-LP|4EHP|EIF4EL3|IF4e |
| Gene description: | eukaryotic translation initiation factor 4E family member 2 |
| Genbank accession: | BC005392 |
| Immunogen: | EIF4E2 (AAH05392, 1 a.a. ~ 245 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP |
| Protein accession: | AAH05392 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (52.69 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EIF4E2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |