No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009470-M01 |
Product name: | EIF4E2 monoclonal antibody (M01), clone 4G10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant EIF4E2. |
Clone: | 4G10 |
Isotype: | IgG1 Kappa |
Gene id: | 9470 |
Gene name: | EIF4E2 |
Gene alias: | 4E-LP|4EHP|EIF4EL3|IF4e |
Gene description: | eukaryotic translation initiation factor 4E family member 2 |
Genbank accession: | BC005392 |
Immunogen: | EIF4E2 (AAH05392, 1 a.a. ~ 245 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP |
Protein accession: | AAH05392 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (52.69 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to EIF4E2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |