EIF4E2 MaxPab mouse polyclonal antibody (B01) View larger

EIF4E2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF4E2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about EIF4E2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00009470-B01
Product name: EIF4E2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human EIF4E2 protein.
Gene id: 9470
Gene name: EIF4E2
Gene alias: 4E-LP|4EHP|EIF4EL3|IF4e
Gene description: eukaryotic translation initiation factor 4E family member 2
Genbank accession: NM_004846.2
Immunogen: EIF4E2 (AAH21690.1, 1 a.a. ~ 245 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Protein accession: AAH21690.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009470-B01-13-15-1.jpg
Application image note: Western Blot analysis of EIF4E2 expression in transfected 293T cell line (H00009470-T01) by EIF4E2 MaxPab polyclonal antibody.

Lane 1: EIF4E2 transfected lysate(26.95 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EIF4E2 MaxPab mouse polyclonal antibody (B01) now

Add to cart