Brand: | Abnova |
Reference: | H00009469-M02 |
Product name: | CHST3 monoclonal antibody (M02), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHST3. |
Clone: | 1D3 |
Isotype: | IgG2a Kappa |
Gene id: | 9469 |
Gene name: | CHST3 |
Gene alias: | C6ST|C6ST1|HSD |
Gene description: | carbohydrate (chondroitin 6) sulfotransferase 3 |
Genbank accession: | NM_004273 |
Immunogen: | CHST3 (NP_004264, 312 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG |
Protein accession: | NP_004264 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CHST3 monoclonal antibody (M02), clone 1D3. Western Blot analysis of CHST3 expression in Hela S3 NE(Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |