Brand: | Abnova |
Reference: | H00009465-M01 |
Product name: | AKAP7 monoclonal antibody (M01), clone 2B3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant AKAP7. |
Clone: | 2B3 |
Isotype: | IgG2a Kappa |
Gene id: | 9465 |
Gene name: | AKAP7 |
Gene alias: | AKAP18 |
Gene description: | A kinase (PRKA) anchor protein 7 |
Genbank accession: | BC016927 |
Immunogen: | AKAP7 (AAH16927, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK |
Protein accession: | AAH16927 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |