Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 749,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 749,00 €
Data sheet of AKAP7 monoclonal antibody (M01), clone 2B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about AKAP7 monoclonal antibody (M01), clone 2B3
| Brand: | Abnova |
| Reference: | H00009465-M01 |
| Product name: | AKAP7 monoclonal antibody (M01), clone 2B3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant AKAP7. |
| Clone: | 2B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9465 |
| Gene name: | AKAP7 |
| Gene alias: | AKAP18 |
| Gene description: | A kinase (PRKA) anchor protein 7 |
| Genbank accession: | BC016927 |
| Immunogen: | AKAP7 (AAH16927, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK |
| Protein accession: | AAH16927 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |