Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009464-M01 |
Product name: | HAND2 monoclonal antibody (M01), clone 4H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HAND2. |
Clone: | 4H8 |
Isotype: | IgG2a Kappa |
Gene id: | 9464 |
Gene name: | HAND2 |
Gene alias: | DHAND2|FLJ16260|Hed|MGC125303|MGC125304|Thing2|bHLHa26|dHand |
Gene description: | heart and neural crest derivatives expressed 2 |
Genbank accession: | NM_021973 |
Immunogen: | HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK |
Protein accession: | NP_068808.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody (M01), clone 4H8. Lane 1: HAND2 transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |