| Brand: | Abnova |
| Reference: | H00009463-M01 |
| Product name: | PRKCABP monoclonal antibody (M01), clone 3G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKCABP. |
| Clone: | 3G5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9463 |
| Gene name: | PICK1 |
| Gene alias: | MGC15204|PICK|PRKCABP |
| Gene description: | protein interacting with PRKCA 1 |
| Genbank accession: | NM_012407 |
| Immunogen: | PRKCABP (NP_036539, 266 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ |
| Protein accession: | NP_036539 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PRKCABP monoclonal antibody (M01), clone 3G5. Western Blot analysis of PICK1 expression in rat brain. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |