No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009463-M01 |
Product name: | PRKCABP monoclonal antibody (M01), clone 3G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKCABP. |
Clone: | 3G5 |
Isotype: | IgG2a Kappa |
Gene id: | 9463 |
Gene name: | PICK1 |
Gene alias: | MGC15204|PICK|PRKCABP |
Gene description: | protein interacting with PRKCA 1 |
Genbank accession: | NM_012407 |
Immunogen: | PRKCABP (NP_036539, 266 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ |
Protein accession: | NP_036539 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | PRKCABP monoclonal antibody (M01), clone 3G5. Western Blot analysis of PICK1 expression in rat brain. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |