GGPS1 monoclonal antibody (M08), clone 1C3 View larger

GGPS1 monoclonal antibody (M08), clone 1C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GGPS1 monoclonal antibody (M08), clone 1C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GGPS1 monoclonal antibody (M08), clone 1C3

Brand: Abnova
Reference: H00009453-M08
Product name: GGPS1 monoclonal antibody (M08), clone 1C3
Product description: Mouse monoclonal antibody raised against a partial recombinant GGPS1.
Clone: 1C3
Isotype: IgG2b Kappa
Gene id: 9453
Gene name: GGPS1
Gene alias: GGPPS|GGPPS1
Gene description: geranylgeranyl diphosphate synthase 1
Genbank accession: NM_004837
Immunogen: GGPS1 (NP_004828, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
Protein accession: NP_004828
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009453-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009453-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GGPS1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GGPS1 monoclonal antibody (M08), clone 1C3 now

Add to cart