| Brand: | Abnova |
| Reference: | H00009450-M01 |
| Product name: | LY86 monoclonal antibody (M01), clone 1H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LY86. |
| Clone: | 1H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9450 |
| Gene name: | LY86 |
| Gene alias: | MD-1|MMD-1|dJ80N2.1 |
| Gene description: | lymphocyte antigen 86 |
| Genbank accession: | BC038846 |
| Immunogen: | LY86 (AAH38846, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGP |
| Protein accession: | AAH38846 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged LY86 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |