No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00009450-M01 |
Product name: | LY86 monoclonal antibody (M01), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LY86. |
Clone: | 1H3 |
Isotype: | IgG2a Kappa |
Gene id: | 9450 |
Gene name: | LY86 |
Gene alias: | MD-1|MMD-1|dJ80N2.1 |
Gene description: | lymphocyte antigen 86 |
Genbank accession: | BC038846 |
Immunogen: | LY86 (AAH38846, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGP |
Protein accession: | AAH38846 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged LY86 is approximately 0.3ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |