Brand: | Abnova |
Reference: | H00009448-M01 |
Product name: | MAP4K4 monoclonal antibody (M01), clone 2D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP4K4. |
Clone: | 2D4 |
Isotype: | IgG2a Kappa |
Gene id: | 9448 |
Gene name: | MAP4K4 |
Gene alias: | FLH21957|FLJ10410|FLJ20373|FLJ90111|HGK|KIAA0687|NIK |
Gene description: | mitogen-activated protein kinase kinase kinase kinase 4 |
Genbank accession: | NM_145686 |
Immunogen: | MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV |
Protein accession: | NP_663719 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MAP4K4 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |