GSTO1 monoclonal antibody (M03), clone 1B6 View larger

GSTO1 monoclonal antibody (M03), clone 1B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTO1 monoclonal antibody (M03), clone 1B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GSTO1 monoclonal antibody (M03), clone 1B6

Brand: Abnova
Reference: H00009446-M03
Product name: GSTO1 monoclonal antibody (M03), clone 1B6
Product description: Mouse monoclonal antibody raised against a partial recombinant GSTO1.
Clone: 1B6
Isotype: IgG1 Kappa
Gene id: 9446
Gene name: GSTO1
Gene alias: DKFZp686H13163|GSTTLp28|P28
Gene description: glutathione S-transferase omega 1
Genbank accession: NM_004832
Immunogen: GSTO1 (NP_004823, 121 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED
Protein accession: NP_004823
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009446-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009446-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged GSTO1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GSTO1 monoclonal antibody (M03), clone 1B6 now

Add to cart