Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITM2B purified MaxPab rabbit polyclonal antibody (D03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about ITM2B purified MaxPab rabbit polyclonal antibody (D03P)
| Brand: | Abnova |
| Reference: | H00009445-D03P |
| Product name: | ITM2B purified MaxPab rabbit polyclonal antibody (D03P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ITM2B protein. |
| Gene id: | 9445 |
| Gene name: | ITM2B |
| Gene alias: | ABRI|BRI|BRI2|BRICD2B|E25B|E3-16|FBD |
| Gene description: | integral membrane protein 2B |
| Genbank accession: | BC016148.1 |
| Immunogen: | ITM2B (AAH16148.1, 1 a.a. ~ 266 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS |
| Protein accession: | AAH16148.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | ITM2B MaxPab rabbit polyclonal antibody. Western Blot analysis of ITM2B expression in mouse liver. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |