| Brand: | Abnova |
| Reference: | H00009443-M02 |
| Product name: | CRSP9 monoclonal antibody (M02), clone 2D7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CRSP9. |
| Clone: | 2D7 |
| Isotype: | IgG2b |
| Gene id: | 9443 |
| Gene name: | MED7 |
| Gene alias: | CRSP33|CRSP9|MGC12284 |
| Gene description: | mediator complex subunit 7 |
| Genbank accession: | BC005250 |
| Immunogen: | CRSP9 (AAH05250, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP |
| Protein accession: | AAH05250 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | CRSP9 monoclonal antibody (M02), clone 2D7 Western Blot analysis of CRSP9 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |