| Brand: | Abnova |
| Reference: | H00009440-M02 |
| Product name: | CRSP6 monoclonal antibody (M02), clone 1B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CRSP6. |
| Clone: | 1B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9440 |
| Gene name: | MED17 |
| Gene alias: | CRSP6|CRSP77|DRIP80|FLJ10812|TRAP80 |
| Gene description: | mediator complex subunit 17 |
| Genbank accession: | BC021101 |
| Immunogen: | CRSP6 (AAH21101, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL |
| Protein accession: | AAH21101 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CRSP6 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mediator complex recruits epigenetic regulators via its two cyclin-dependent kinase subunits to repress transcription of immune-response genes.Tsutsui T, Fukasawa R, Shinmyouzu K, Nakagawa R, Tobe K, Tanaka A, Ohkuma Y J Biol Chem. 2013 Jun 9. |