| Brand: | Abnova |
| Reference: | H00009440-M01 |
| Product name: | CRSP6 monoclonal antibody (M01), clone 4D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CRSP6. |
| Clone: | 4D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9440 |
| Gene name: | MED17 |
| Gene alias: | CRSP6|CRSP77|DRIP80|FLJ10812|TRAP80 |
| Gene description: | mediator complex subunit 17 |
| Genbank accession: | BC021101 |
| Immunogen: | CRSP6 (AAH21101, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL |
| Protein accession: | AAH21101 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CRSP6 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.Kikuchi Y, Umemura H, Nishitani S, Iida S, Fukasawa R, Hayashi H, Hirose Y, Tanaka A, Sugasawa K, Ohkuma Y Genes Cells. 2014 Dec 7. doi: 10.1111/gtc.12210. |