No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00009425-M02 |
| Product name: | CDYL monoclonal antibody (M02), clone 1A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDYL. |
| Clone: | 1A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9425 |
| Gene name: | CDYL |
| Gene alias: | CDYL1|DKFZp586C1622|MGC131936 |
| Gene description: | chromodomain protein, Y-like |
| Genbank accession: | NM_004824 |
| Immunogen: | CDYL (NP_004815.2, 153 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNMDLAKSGIKILVPKSPVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRI |
| Protein accession: | NP_004815.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to CDYL on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.Bantscheff M, Hopf C, Savitski MM, Dittmann A, Grandi P, Michon AM, Schlegl J, Abraham Y, Becher I, Bergamini G, Boesche M, Delling M, Dumpelfeld B, Eberhard D, Huthmacher C, Mathieson T, Poeckel D, Reader V, Strunk K, Sweetman G, Kruse U, Neubauer G, Ramsden NG, Drewes G. Nat Biotechnol. 2011 Jan 23. [Epub ahead of print] |