No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00009420-M06 |
| Product name: | CYP7B1 monoclonal antibody (M06), clone 2B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP7B1. |
| Clone: | 2B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9420 |
| Gene name: | CYP7B1 |
| Gene alias: | CBAS3|CP7B|SPG5A |
| Gene description: | cytochrome P450, family 7, subfamily B, polypeptide 1 |
| Genbank accession: | NM_004820 |
| Immunogen: | CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH |
| Protein accession: | NP_004811 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CYP7B1 expression in transfected 293T cell line by CYP7B1 monoclonal antibody (M06), clone 2B11. Lane 1: CYP7B1 transfected lysate(58.256 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |