Cart 28 Product Products 10 900,13 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x BAF170...259,07 € -
-
-
-
-
-
-
-
No products
To be determined Shipping
10 900,13 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 900,13 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 900,13 €
Data sheet of CYP7B1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CYP7B1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009420-A01 |
| Product name: | CYP7B1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CYP7B1. |
| Gene id: | 9420 |
| Gene name: | CYP7B1 |
| Gene alias: | CBAS3|CP7B|SPG5A |
| Gene description: | cytochrome P450, family 7, subfamily B, polypeptide 1 |
| Genbank accession: | NM_004820 |
| Immunogen: | CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH |
| Protein accession: | NP_004811 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | CYP7B1 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of CYP7B1 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |