| Brand: | Abnova |
| Reference: | H00009419-M03 |
| Product name: | CRIPT monoclonal antibody (M03), clone 4D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CRIPT. |
| Clone: | 4D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9419 |
| Gene name: | CRIPT |
| Gene alias: | HSPC139 |
| Gene description: | cysteine-rich PDZ-binding protein |
| Genbank accession: | NM_014171 |
| Immunogen: | CRIPT (NP_054890.1, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV |
| Protein accession: | NP_054890.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CRIPT is 0.03 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |