No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009413-M01 |
Product name: | C9orf61 monoclonal antibody (M01), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C9orf61. |
Clone: | 1H3 |
Isotype: | IgG2a Kappa |
Gene id: | 9413 |
Gene name: | C9orf61 |
Gene alias: | MGC142243|MGC142245|RP11-548B3.1|X123 |
Gene description: | chromosome 9 open reading frame 61 |
Genbank accession: | NM_004816 |
Immunogen: | C9orf61 (NP_004807, 383 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QIMAPLQPSTSRAHRLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL |
Protein accession: | NP_004807 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.59 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | C9orf61 monoclonal antibody (M01), clone 1H3 Western Blot analysis of C9orf61 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |