View larger

ZNF265 monoclonal antibody (M02), clone 2A11

Reference:

Condition: New product

Data sheet of ZNF265 monoclonal antibody (M02), clone 2A11

Brand:	Abnova
Reference:	H00009406-M02
Product name:	ZNF265 monoclonal antibody (M02), clone 2A11
Product description:	Mouse monoclonal antibody raised against a partial recombinant ZNF265.
Clone:	2A11
Isotype:	IgG1 Kappa
Gene id:	9406
Gene name:	ZRANB2
Gene alias:	DKFZp686J1831\|DKFZp686N09117\|FLJ41119\|ZIS\|ZIS1\|ZIS2\|ZNF265
Gene description:	zinc finger, RAN-binding domain containing 2
Genbank accession:	NM_005455
Immunogen:	ZNF265 (NP_005446, 1 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGF
Protein accession:	NP_005446
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.4 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Mouse,Rat
Application image:
Application image note:	ZNF265 monoclonal antibody (M02), clone 2A11 Western Blot analysis of ZNF265 expression in Jurkat ( Cat # L017V1 ).
Applications:	WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice