Cart 31 Product Products 8 100,15 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x AIF-M1...259,07 € -
1 x Dynamin I...259,07 € -
-
-
-
-
-
-
1 x NIM1...259,07 € -
-
-
-
-
1 x MKP-4...259,07 € -
No products
To be determined Shipping
8 100,15 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 31 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 100,15 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 100,15 €
Data sheet of LIPG polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about LIPG polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009388-A01 |
| Product name: | LIPG polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LIPG. |
| Gene id: | 9388 |
| Gene name: | LIPG |
| Gene alias: | EDL|EL|PRO719 |
| Gene description: | lipase, endothelial |
| Genbank accession: | NM_006033 |
| Immunogen: | LIPG (NP_006024, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR |
| Protein accession: | NP_006024 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LIPG polyclonal antibody (A01), Lot # 070129JCSb Western Blot analysis of LIPG expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |