NRXN1 polyclonal antibody (A01) View larger

NRXN1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NRXN1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NRXN1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009378-A01
Product name: NRXN1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NRXN1.
Gene id: 9378
Gene name: NRXN1
Gene alias: DKFZp313P2036|FLJ35941|Hs.22998|KIAA0578
Gene description: neurexin 1
Genbank accession: NM_004801
Immunogen: NRXN1 (NP_004792, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
Protein accession: NP_004792
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009378-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Differentially expressed gene profile in the 6-hydroxy-dopamine-induced cell culture model of Parkinson's disease.Noelker C, Schwake M, Balzer-Geldsetzer M, Bacher M, Popp J, Schlegel J, Eggert K, Oertel WH, Klockgether T, Dodel R.
Neurosci Lett. 2011 Dec 1.

Reviews

Buy NRXN1 polyclonal antibody (A01) now

Add to cart