Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 044,62 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 044,62 €
Data sheet of ADIPOQ polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about ADIPOQ polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009370-A01 |
| Product name: | ADIPOQ polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ADIPOQ. |
| Gene id: | 9370 |
| Gene name: | ADIPOQ |
| Gene alias: | ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin |
| Gene description: | adiponectin, C1Q and collagen domain containing |
| Genbank accession: | NM_004797 |
| Immunogen: | ADIPOQ (NP_004788, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ |
| Protein accession: | NP_004788 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | ADIPOQ polyclonal antibody (A01). Western Blot analysis of ADIPOQ expression in rat adipocytes. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Grafted-double walled carbotn nanotubes as electrochemical platforms for immobilization of antibodies using a metallic-complex chelating polymer: Application to the determination of adiponectin cytokine in serum.Ojedaa I, Barrejonb M, Arellanob LM, Gonzalez-Cortesa A, Yanez-Sedenoa P, Langab F, Pingarrona JM. Biosensors and Bioelectronics. 2015 Jun. [Epub ahead of print] |