Cart 8 Product Products 2 145,35 € (empty)
No products
To be determined Shipping
2 145,35 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 145,35 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 145,35 €
Data sheet of RAB28 purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about RAB28 purified MaxPab mouse polyclonal antibody (B03P)
| Brand: | Abnova |
| Reference: | H00009364-B03P |
| Product name: | RAB28 purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human RAB28 protein. |
| Gene id: | 9364 |
| Gene name: | RAB28 |
| Gene alias: | MGC41862 |
| Gene description: | RAB28, member RAS oncogene family |
| Genbank accession: | BC018067 |
| Immunogen: | RAB28 (AAH18067, 1 a.a. ~ 95 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQLIWSICEQ |
| Protein accession: | AAH18067 |
| Storage buffer: | In 1x PBS, pH 7.2 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RAB28 expression in transfected 293T cell line (H00009364-T04) by RAB28 MaxPab polyclonal antibody. Lane 1: RAB28 transfected lysate(10.56 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |