RAB28 purified MaxPab mouse polyclonal antibody (B02P) View larger

RAB28 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB28 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RAB28 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00009364-B02P
Product name: RAB28 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human RAB28 protein.
Gene id: 9364
Gene name: RAB28
Gene alias: MGC41862
Gene description: RAB28, member RAS oncogene family
Genbank accession: NM_001017979.1
Immunogen: RAB28 (NP_001017979.1, 1 a.a. ~ 221 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAVQ
Protein accession: NP_001017979.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009364-B02P-13-15-1.jpg
Application image note: Western Blot analysis of RAB28 expression in transfected 293T cell line (H00009364-T02) by RAB28 MaxPab polyclonal antibody.

Lane 1: RAB28 transfected lysate(24.31 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB28 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart