Brand: | Abnova |
Reference: | H00009363-M04 |
Product name: | RAB33A monoclonal antibody (M04), clone 8A11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RAB33A. |
Clone: | 8A11 |
Isotype: | IgG2a Kappa |
Gene id: | 9363 |
Gene name: | RAB33A |
Gene alias: | MGC1488|RabS10 |
Gene description: | RAB33A, member RAS oncogene family |
Genbank accession: | BC009996 |
Immunogen: | RAB33A (AAH09996, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC |
Protein accession: | AAH09996 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RAB33A monoclonal antibody (M04), clone 8A11. Western Blot analysis of RAB33A expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |