| Brand: | Abnova |
| Reference: | H00009360-M01 |
| Product name: | PPIG monoclonal antibody (M01), clone 4F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPIG. |
| Clone: | 4F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9360 |
| Gene name: | PPIG |
| Gene alias: | CARS-Cyp|CYP|MGC133241|SRCyp |
| Gene description: | peptidylprolyl isomerase G (cyclophilin G) |
| Genbank accession: | NM_004792 |
| Immunogen: | PPIG (NP_004783, 13 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNK |
| Protein accession: | NP_004783 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |