Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC22A6 monoclonal antibody (M05), clone 1F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about SLC22A6 monoclonal antibody (M05), clone 1F2
| Brand: | Abnova |
| Reference: | H00009356-M05 |
| Product name: | SLC22A6 monoclonal antibody (M05), clone 1F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC22A6. |
| Clone: | 1F2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9356 |
| Gene name: | SLC22A6 |
| Gene alias: | FLJ55736|HOAT1|MGC45260|OAT1|PAHT|ROAT1 |
| Gene description: | solute carrier family 22 (organic anion transporter), member 6 |
| Genbank accession: | BC033682 |
| Immunogen: | SLC22A6 (AAH33682, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL |
| Protein accession: | AAH33682 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SLC22A6 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |