| Brand: | Abnova |
| Reference: | H00009352-M01 |
| Product name: | TXNL1 monoclonal antibody (M01), clone 1A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TXNL1. |
| Clone: | 1A10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9352 |
| Gene name: | TXNL1 |
| Gene alias: | TRP32|TXL-1|TXNL|Txl |
| Gene description: | thioredoxin-like 1 |
| Genbank accession: | BC001156 |
| Immunogen: | TXNL1 (AAH01156, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH |
| Protein accession: | AAH01156 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TXNL1 monoclonal antibody (M01), clone 1A10 Western Blot analysis of TXNL1 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jornvall H, Auer G, Habermann JK. Cell Mol Life Sci. 2011 Feb 3. [Epub ahead of print] |