CER1 monoclonal antibody (M12), clone 4D5 View larger

CER1 monoclonal antibody (M12), clone 4D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CER1 monoclonal antibody (M12), clone 4D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CER1 monoclonal antibody (M12), clone 4D5

Brand: Abnova
Reference: H00009350-M12
Product name: CER1 monoclonal antibody (M12), clone 4D5
Product description: Mouse monoclonal antibody raised against a full length recombinant CER1.
Clone: 4D5
Isotype: IgG2a Kappa
Gene id: 9350
Gene name: CER1
Gene alias: DAND4|MGC119894|MGC119895|MGC96951
Gene description: cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis)
Genbank accession: NM_005454
Immunogen: CER1 (NP_005445.1, 158 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVS
Protein accession: NP_005445.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009350-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged CER1 is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CER1 monoclonal antibody (M12), clone 4D5 now

Add to cart