| Brand: | Abnova |
| Reference: | H00009350-M12 |
| Product name: | CER1 monoclonal antibody (M12), clone 4D5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CER1. |
| Clone: | 4D5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9350 |
| Gene name: | CER1 |
| Gene alias: | DAND4|MGC119894|MGC119895|MGC96951 |
| Gene description: | cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis) |
| Genbank accession: | NM_005454 |
| Immunogen: | CER1 (NP_005445.1, 158 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVS |
| Protein accession: | NP_005445.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged CER1 is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |