Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPL23 monoclonal antibody (M01), clone 2F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RPL23 monoclonal antibody (M01), clone 2F12
| Brand: | Abnova |
| Reference: | H00009349-M01 |
| Product name: | RPL23 monoclonal antibody (M01), clone 2F12 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant RPL23. |
| Clone: | 2F12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9349 |
| Gene name: | RPL23 |
| Gene alias: | MGC111167|MGC117346|MGC72008|rpL17 |
| Gene description: | ribosomal protein L23 |
| Genbank accession: | BC034378 |
| Immunogen: | RPL23 (AAH34378, 1 a.a. ~ 77 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKGE |
| Protein accession: | AAH34378 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |