| Brand: | Abnova |
| Reference: | H00009344-M10A |
| Product name: | TAOK2 monoclonal antibody (M10A), clone 3E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAOK2. |
| Clone: | 3E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9344 |
| Gene name: | TAOK2 |
| Gene alias: | KIAA0881|MAP3K17|PSK|PSK1|TAO1|TAO2 |
| Gene description: | TAO kinase 2 |
| Genbank accession: | BC051798 |
| Immunogen: | TAOK2 (AAH51798, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ |
| Protein accession: | AAH51798 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |