TAOK2 monoclonal antibody (M10A), clone 3E2 View larger

TAOK2 monoclonal antibody (M10A), clone 3E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAOK2 monoclonal antibody (M10A), clone 3E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TAOK2 monoclonal antibody (M10A), clone 3E2

Brand: Abnova
Reference: H00009344-M10A
Product name: TAOK2 monoclonal antibody (M10A), clone 3E2
Product description: Mouse monoclonal antibody raised against a partial recombinant TAOK2.
Clone: 3E2
Isotype: IgG2a Kappa
Gene id: 9344
Gene name: TAOK2
Gene alias: KIAA0881|MAP3K17|PSK|PSK1|TAO1|TAO2
Gene description: TAO kinase 2
Genbank accession: BC051798
Immunogen: TAOK2 (AAH51798, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ
Protein accession: AAH51798
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009344-M10A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAOK2 monoclonal antibody (M10A), clone 3E2 now

Add to cart