Brand: | Abnova |
Reference: | H00009344-M04 |
Product name: | TAOK2 monoclonal antibody (M04), clone 3A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TAOK2. |
Clone: | 3A12 |
Isotype: | IgG2a Kappa |
Gene id: | 9344 |
Gene name: | TAOK2 |
Gene alias: | KIAA0881|MAP3K17|PSK|PSK1|TAO1|TAO2 |
Gene description: | TAO kinase 2 |
Genbank accession: | BC051798 |
Immunogen: | TAOK2 (AAH51798, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ |
Protein accession: | AAH51798 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged TAOK2 is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |