Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SNAP29 monoclonal antibody (M01), clone 3E4-E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SNAP29 monoclonal antibody (M01), clone 3E4-E6
| Brand: | Abnova |
| Reference: | H00009342-M01 |
| Product name: | SNAP29 monoclonal antibody (M01), clone 3E4-E6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SNAP29. |
| Clone: | 3E4-E6 |
| Isotype: | IgG1 kappa |
| Gene id: | 9342 |
| Gene name: | SNAP29 |
| Gene alias: | CEDNIK|FLJ21051|SNAP-29 |
| Gene description: | synaptosomal-associated protein, 29kDa |
| Genbank accession: | BC009715 |
| Immunogen: | SNAP29 (AAH09715, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
| Protein accession: | AAH09715 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SNAP29 expression in transfected 293T cell line by SNAP29 monoclonal antibody (M01), clone 3E4-E6. Lane 1: SNAP29 transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | SNARE protein expression and localization in human cytotoxic T lymphocytes.Pattu V, Qu B, Schwarz EC, Straubeta B, Weins L, Bhat SS, Halimani M, Marshall M, Rettig J, Hoth M. Eur J Immunol. 2011 Nov 25. doi: 10.1002/eji. 201141915. |