| Brand: | Abnova |
| Reference: | H00009334-M01A |
| Product name: | B4GALT5 monoclonal antibody (M01A), clone 4B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant B4GALT5. |
| Clone: | 4B9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9334 |
| Gene name: | B4GALT5 |
| Gene alias: | B4Gal-T5|BETA4-GALT-IV|MGC138470|beta4Gal-T5|beta4GalT-V|gt-V |
| Gene description: | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 |
| Genbank accession: | NM_004776 |
| Immunogen: | B4GALT5 (NP_004767, 48 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGG |
| Protein accession: | NP_004767 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |