No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009334-M01A |
Product name: | B4GALT5 monoclonal antibody (M01A), clone 4B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant B4GALT5. |
Clone: | 4B9 |
Isotype: | IgG1 Kappa |
Gene id: | 9334 |
Gene name: | B4GALT5 |
Gene alias: | B4Gal-T5|BETA4-GALT-IV|MGC138470|beta4Gal-T5|beta4GalT-V|gt-V |
Gene description: | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 |
Genbank accession: | NM_004776 |
Immunogen: | B4GALT5 (NP_004767, 48 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGG |
Protein accession: | NP_004767 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |