No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00009330-M02 |
Product name: | GTF3C3 monoclonal antibody (M02), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GTF3C3. |
Clone: | 3D9 |
Isotype: | IgG2b Kappa |
Gene id: | 9330 |
Gene name: | GTF3C3 |
Gene alias: | TFIIIC102|TFIIICgamma|TFiiiC2-102 |
Gene description: | general transcription factor IIIC, polypeptide 3, 102kDa |
Genbank accession: | NM_012086 |
Immunogen: | GTF3C3 (NP_036218, 112 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TPEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNP |
Protein accession: | NP_036218 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | GTF3C3 monoclonal antibody (M02), clone 3D9 Western Blot analysis of GTF3C3 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |