GTF3C4 polyclonal antibody (A01) View larger

GTF3C4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF3C4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GTF3C4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009329-A01
Product name: GTF3C4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GTF3C4.
Gene id: 9329
Gene name: GTF3C4
Gene alias: FLJ21002|KAT12|MGC138450|TFIII90|TFIIIC90|TFIIICdelta|TFiiiC2-90
Gene description: general transcription factor IIIC, polypeptide 4, 90kDa
Genbank accession: NM_012204
Immunogen: GTF3C4 (NP_036336, 723 a.a. ~ 822 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
Protein accession: NP_036336
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009329-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009329-A01-1-2-1.jpg
Application image note: GTF3C4 polyclonal antibody (A01), Lot # 051019JC01 Western Blot analysis of GTF3C4 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GTF3C4 polyclonal antibody (A01) now

Add to cart