No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00009328-M01 |
Product name: | GTF3C5 monoclonal antibody (M01), clone 3F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GTF3C5. |
Clone: | 3F10 |
Isotype: | IgG2a Kappa |
Gene id: | 9328 |
Gene name: | GTF3C5 |
Gene alias: | FLJ20857|TFIIIC63|TFIIICepsilon|TFiiiC2-63 |
Gene description: | general transcription factor IIIC, polypeptide 5, 63kDa |
Genbank accession: | NM_012087 |
Immunogen: | GTF3C5 (NP_036219, 378 a.a. ~ 485 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTIRSKRPALFSSSAKADGGKEQLTYESG |
Protein accession: | NP_036219 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoprecipitation of GTF3C5 transfected lysate using anti-GTF3C5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GTF3C5 monoclonal antibody. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |