| Brand:  | Abnova | 
| Reference:  | H00009322-M01 | 
| Product name:  | TRIP10 monoclonal antibody (M01), clone 1A9 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TRIP10. | 
| Clone:  | 1A9 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 9322 | 
| Gene name:  | TRIP10 | 
| Gene alias:  | CIP4|HSTP|STOT|STP | 
| Gene description:  | thyroid hormone receptor interactor 10 | 
| Genbank accession:  | NM_004240 | 
| Immunogen:  | TRIP10 (NP_004231, 231 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | YGLLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKNKT | 
| Protein accession:  | NP_004231 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunofluorescence of monoclonal antibody to TRIP10 on HeLa cell . [antibody concentration 10 ug/ml] | 
| Applications:  | IF,ELISA,WB-Re,IP | 
| Shipping condition:  | Dry Ice |