Brand: | Abnova |
Reference: | H00009318-M02 |
Product name: | COPS2 monoclonal antibody (M02), clone 4B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COPS2. |
Clone: | 4B12 |
Isotype: | IgG2a Kappa |
Gene id: | 9318 |
Gene name: | COPS2 |
Gene alias: | ALIEN|CSN2|SGN2|TRIP15 |
Gene description: | COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) |
Genbank accession: | NM_004236 |
Immunogen: | COPS2 (NP_004227, 344 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | REHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
Protein accession: | NP_004227 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | COPS2 monoclonal antibody (M02), clone 4B12. Western Blot analysis of COPS2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |