| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00009314-M02 | 
| Product name: | KLF4 monoclonal antibody (M02), clone X1 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF4. | 
| Clone: | X1 | 
| Isotype: | IgG1 Kappa | 
| Gene id: | 9314 | 
| Gene name: | KLF4 | 
| Gene alias: | EZF|GKLF | 
| Gene description: | Kruppel-like factor 4 (gut) | 
| Genbank accession: | BC029923 | 
| Immunogen: | KLF4 (AAH29923, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD | 
| Protein accession: | AAH29923 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of KLF4 expression in transfected 293T cell line by KLF4 monoclonal antibody (M02), clone X1. Lane 1: KLF4 transfected lysate(50.1 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice |