| Brand:  | Abnova | 
| Reference:  | H00009308-M02 | 
| Product name:  | CD83 monoclonal antibody (M02), clone 3F3 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant CD83. | 
| Clone:  | 3F3 | 
| Isotype:  | IgG2a kappa | 
| Gene id:  | 9308 | 
| Gene name:  | CD83 | 
| Gene alias:  | BL11|HB15 | 
| Gene description:  | CD83 molecule | 
| Genbank accession:  | BC030830 | 
| Immunogen:  | CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV | 
| Protein accession:  | AAH30830 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (48.29 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged CD83 is approximately 1ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |