Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD83 monoclonal antibody (M01), clone 3G10-1F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about CD83 monoclonal antibody (M01), clone 3G10-1F4
| Brand: | Abnova |
| Reference: | H00009308-M01 |
| Product name: | CD83 monoclonal antibody (M01), clone 3G10-1F4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CD83. |
| Clone: | 3G10-1F4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9308 |
| Gene name: | CD83 |
| Gene alias: | BL11|HB15 |
| Gene description: | CD83 molecule |
| Genbank accession: | BC030830 |
| Immunogen: | CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV |
| Protein accession: | AAH30830 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CD83 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Zwitterionic polymer-coated immunobeads for blood-based cancer diagnostics.Kim G, Yong Y, Kang HJ, Park K, Kim SI, Lee M, Huh N Biomaterials. 2014 Jan;35(1):294-303. doi: 10.1016/j.biomaterials.2013.09.101. Epub 2013 Oct 18. |