Brand: | Abnova |
Reference: | H00009283-A01 |
Product name: | GPR37L1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GPR37L1. |
Gene id: | 9283 |
Gene name: | GPR37L1 |
Gene alias: | ET(B)R-LP-2|ETBR-LP-2 |
Gene description: | G protein-coupled receptor 37 like 1 |
Genbank accession: | NM_004767 |
Immunogen: | GPR37L1 (NP_004758, 27 a.a. ~ 130 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSA |
Protein accession: | NP_004758 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GPR37L1 polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of GPR37L1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |