Cart 17 Product Products 18 487,05 € (empty)
-
-
-
-
-
-
-
-
-
1 x Transferri...259,07 € -
-
-
-
-
-
-
-
No products
To be determined Shipping
18 487,05 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 487,05 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 487,05 €
Data sheet of BCL7B monoclonal antibody (M02), clone 4G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about BCL7B monoclonal antibody (M02), clone 4G1
| Brand: | Abnova |
| Reference: | H00009275-M02 |
| Product name: | BCL7B monoclonal antibody (M02), clone 4G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BCL7B. |
| Clone: | 4G1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9275 |
| Gene name: | BCL7B |
| Gene alias: | - |
| Gene description: | B-cell CLL/lymphoma 7B |
| Genbank accession: | NM_001707 |
| Immunogen: | BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
| Protein accession: | NP_001698 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M02), clone 4G1. Lane 1: BCL7B transfected lysate(22.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |