Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BCL7B monoclonal antibody (M01), clone 6D2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BCL7B monoclonal antibody (M01), clone 6D2
| Brand: | Abnova |
| Reference: | H00009275-M01 |
| Product name: | BCL7B monoclonal antibody (M01), clone 6D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BCL7B. |
| Clone: | 6D2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9275 |
| Gene name: | BCL7B |
| Gene alias: | - |
| Gene description: | B-cell CLL/lymphoma 7B |
| Genbank accession: | NM_001707 |
| Immunogen: | BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
| Protein accession: | NP_001698 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2. Lane 1: BCL7B transfected lysate(22 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | BCL7B, a predictor of poor prognosis of pancreatic cancers, promotes cell motility and invasion by influencing CREB signaling.Taniuchi K, Furihata M, Naganuma S, Dabanaka K, Hanazaki K, Saibara T. Am J Cancer Res. 2018 Mar 1;8(3):387-404. |