View larger

BCL7B polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of BCL7B polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00009275-A01
Product name:	BCL7B polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant BCL7B.
Gene id:	9275
Gene name:	BCL7B
Gene alias:	-
Gene description:	B-cell CLL/lymphoma 7B
Genbank accession:	NM_001707
Immunogen:	BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Protein accession:	NP_001698
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (34.8 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice