Brand: | Abnova |
Reference: | H00009274-M01 |
Product name: | BCL7C monoclonal antibody (M01), clone 5F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BCL7C. |
Clone: | 5F1 |
Isotype: | IgG2a Kappa |
Gene id: | 9274 |
Gene name: | BCL7C |
Gene alias: | - |
Gene description: | B-cell CLL/lymphoma 7C |
Genbank accession: | NM_004765 |
Immunogen: | BCL7C (NP_004756, 86 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT |
Protein accession: | NP_004756 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged BCL7C is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |