| Brand: | Abnova |
| Reference: | H00009266-D01 |
| Product name: | CYTH2 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CYTH2 protein. |
| Gene id: | 9266 |
| Gene name: | CYTH2 |
| Gene alias: | ARNO|CTS18|CTS18.1|PSCD2|PSCD2L|SEC7L|Sec7p-L|Sec7p-like |
| Gene description: | cytohesin 2 |
| Genbank accession: | NM_017457.3 |
| Immunogen: | CYTH2 (NP_059431.1, 1 a.a. ~ 400 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP |
| Protein accession: | NP_059431.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of CYTH2 transfected lysate using anti-CYTH2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CYTH2 MaxPab mouse polyclonal antibody (B01) (H00009266-B01). |
| Applications: | IF,WB-Tr,IP |
| Shipping condition: | Dry Ice |